PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA40629
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family MYB_related
Protein Properties Length: 74aa    MW: 8784.22 Da    PI: 10.5881
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA40629genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61.1e-162168148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g W++eEde+l ++  + G g+W+ +ar  g+ R++k+c++rw +yl
  Tp57577_TGAC_v2_mRNA40629 21 KGLWSPEEDEKLMNYMVRNGQGCWSDVARNAGLERCGKSCRLRWINYL 68
                               678*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.8E-231374IPR009057Homeodomain-like
SuperFamilySSF466894.19E-171674IPR009057Homeodomain-like
PROSITE profilePS5129423.8171672IPR017930Myb domain
SMARTSM007172.2E-112070IPR001005SANT/Myb domain
PfamPF002493.9E-152168IPR001005SANT/Myb domain
CDDcd001671.48E-82468No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 74 aa     Download sequence    Send to blast
MRKPEVCSTK NNNINKKKLR KGLWSPEEDE KLMNYMVRNG QGCWSDVARN AGLERCGKSC  60
RLRWINYLRP DLKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1463302e-90AC146330.33 Medicago truncatula clone mth2-7g7, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003597423.22e-38myb transcription factor
SwissprotQ9LXV22e-35MYB46_ARATH; Transcription factor MYB46
TrEMBLG7IS012e-38G7IS01_MEDTR; Myb transcription factor
STRINGGLYMA11G14200.22e-37(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.16e-35myb domain protein 46